Structure of PDB 4xej Chain BL28

Receptor sequence
>4xejBL28 (length=88) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
SGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRVRVAGQE
ITFRVAASHIPKVYELVERAKGLRLEGLSPKEIKKELL
3D structure
PDB4xej Initiation of translation in bacteria by a structured eukaryotic IRES RNA.
ChainBL28
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BL28 S8 I18 R20 R21 R26 V30 G31 K33 T34 K39 R40 R41 Q42 Y43 P44 N45 Q47 K48 G79 R81 G84 K92 S1 I11 R13 R14 R19 V23 G24 K26 T27 K32 R33 R34 Q35 Y36 P37 N38 Q40 K41 G72 R74 G77 K85
Gene Ontology
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4xej, PDBe:4xej, PDBj:4xej
PDBsum4xej
PubMed25652826
UniProtQ72G84|RL28_THET2 Large ribosomal subunit protein bL28 (Gene Name=rpmB)

[Back to BioLiP]