Structure of PDB 6n1d Chain BL27

Receptor sequence

>6n1dBL27 (length=82) Species: 274 (Thermus thermophilus)

KKGLGSTRNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKNVGM
GRDFTLFALVDGVVEFQDRGRLGRYVHVRPLA

3D structure

• PDB: 6n1d Spontaneous ribosomal translocation of mRNA and tRNAs into a chimeric hybrid state.
• Chain: BL27
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BL27	S9 T10 N12 R14 D15 S16 Q17 A18 K19 R20 K24 Y26 E27 Q29 R32 A33 N35 I36 R39 R41 G42 T43 R44 R55 D56 F57 F60 F69 R77	S6 T7 N9 R11 D12 S13 Q14 A15 K16 R17 K21 Y23 E24 Q26 R29 A30 N32 I33 R36 R38 G39 T40 R41 R52 D53 F54 F57 F66 R74
BS02	rna	BL27	K5 L7 G8 R11	K2 L4 G5 R8

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6n1d, PDBe:6n1d, PDBj:6n1d
• PDBsum: 6n1d
• PubMed: 30936299
• UniProt: Q72HR3|RL27_THET2 Large ribosomal subunit protein bL27 (Gene Name=rpmA)