Structure of PDB 4xej Chain BL27

Receptor sequence
>4xejBL27 (length=76) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
TKNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKNVGMGRDFTL
FALVDGVVEFQDRGRLGRYVHVRPLA
3D structure
PDB4xej Initiation of translation in bacteria by a structured eukaryotic IRES RNA.
ChainBL27
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BL27 N12 R14 D15 S16 A18 K19 R20 K24 Y26 E27 G28 Q29 A33 G34 N35 I36 R39 R41 T43 R44 G54 R55 D56 F57 F60 F69 L75 R77 N3 R5 D6 S7 A9 K10 R11 K15 Y17 E18 G19 Q20 A24 G25 N26 I27 R30 R32 T34 R35 G45 R46 D47 F48 F51 F60 L66 R68
BS02 rna BL27 R72 R74 L75 R63 R65 L66
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4xej, PDBe:4xej, PDBj:4xej
PDBsum4xej
PubMed25652826
UniProtQ72HR3|RL27_THET2 Large ribosomal subunit protein bL27 (Gene Name=rpmA)

[Back to BioLiP]