Structure of PDB 4xej Chain BL18

Receptor sequence
>4xejBL18 (length=98) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
KFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSASSLALKLKG
NKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALAEGAREG
3D structure
PDB4xej Initiation of translation in bacteria by a structured eukaryotic IRES RNA.
ChainBL18
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BL18 K11 F12 R13 R17 I18 T21 Q84 F87 R89 Y94 K1 F2 R3 R7 I8 T11 Q74 F77 R79 Y84
BS02 rna BL18 F29 R30 S31 L32 K33 H34 Y36 Q38 G45 V46 T47 S50 N61 K62 T63 Y92 K93 H95 G96 R97 F19 R20 S21 L22 K23 H24 Y26 Q28 G35 V36 T37 S40 N51 K52 T53 Y82 K83 H85 G86 R87
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4xej, PDBe:4xej, PDBj:4xej
PDBsum4xej
PubMed25652826
UniProtQ72I20|RL18_THET2 Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]