Structure of PDB 4xej Chain BL11

Receptor sequence
>4xejBL11 (length=147) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
MKKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGD
AIVPVEITIYADRSFTFVTKTPPASYLIRKAAGLEKGAHKPGREKVGRIT
WEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEVVGAPEVKDA
3D structure
PDB4xej Initiation of translation in bacteria by a structured eukaryotic IRES RNA.
ChainBL11
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BL11 V8 K9 Q11 P22 Q29 P54 S75 K86 G87 H89 P91 K111 L115 N116 T118 A122 R125 M126 G129 S133 M134 V8 K9 Q11 P22 Q29 P54 S75 K86 G87 H89 P91 K111 L115 N116 T118 A122 R125 M126 G129 S133 M134
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4xej, PDBe:4xej, PDBj:4xej
PDBsum4xej
PubMed25652826
UniProtP62442|RL11_THET2 Large ribosomal subunit protein uL11 (Gene Name=rplK)

[Back to BioLiP]