Structure of PDB 6n1d Chain BL05

Receptor sequence

>6n1dBL05 (length=181) Species: 262724 (Thermus thermophilus HB27)

PLDLALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK

3D structure

• PDB: 6n1d Spontaneous ribosomal translocation of mRNA and tRNAs into a chimeric hybrid state.
• Chain: BL05
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BL05	V38 N40 G42 L43 G44 T71 A73 K74 F80 L82 R91 S124 D126 N132 L133 G134 L135 R136 R153 G154 M155 D156 V160	V37 N39 G41 L42 G43 T70 A72 K73 F79 L81 R90 S123 D125 N131 L132 G133 L134 R135 R152 G153 M154 D155 V159
BS02	rna	BL05	N27 W29 E30 Q66 K67 P68 A69 V70 R91 T93 R95 R96 R98	N26 W28 E29 Q65 K66 P67 A68 V69 R90 T92 R94 R95 R97
BS03	rna	BL05	S76 I77 S78 F80	S75 I76 S77 F79

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6n1d, PDBe:6n1d, PDBj:6n1d
• PDBsum: 6n1d
• PubMed: 30936299
• UniProt: Q72I16|RL5_THET2 Large ribosomal subunit protein uL5 (Gene Name=rplE)