Structure of PDB 4xej Chain BL05

Receptor sequence

>4xejBL05 (length=181) Species: 262724 (Thermus thermophilus HB27)

PLDLALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK

3D structure

• PDB: 4xej Initiation of translation in bacteria by a structured eukaryotic IRES RNA.
• Chain: BL05
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BL05	N40 G42 E45 T71 R72 A73 K74 I77 N79 F80 L82 G89 R91 S124 D126 N132 G134 L135 R136 G154 D156	N39 G41 E44 T70 R71 A72 K73 I76 N78 F79 L81 G88 R90 S123 D125 N131 G133 L134 R135 G153 D155
BS02	rna	BL05	N27 W29 Q66 K67 P68 A69 R91 T93 R95 R96 R98	N26 W28 Q65 K66 P67 A68 R90 T92 R94 R95 R97

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4xej, PDBe:4xej, PDBj:4xej
• PDBsum: 4xej
• PubMed: 25652826
• UniProt: Q72I16|RL5_THET2 Large ribosomal subunit protein uL5 (Gene Name=rplE)