Structure of PDB 6n1d Chain BL03

Receptor sequence

>6n1dBL03 (length=204) Species: 262724 (Thermus thermophilus HB27)

MKGILGVKVGMTRIFRDDRAVPVTVILAGPCPVVQRRTPEKDGYTAVQLG
FLPQNPKRVNRPLKGHFAKAGVEPVRILREIRDFNPEGDTVTVEIFKPGE
RVDVTGTSKGRGFAGVMKRWNFAGGPDSHGAHKIHRHPGSIGNRKTPGRV
YKGKKMAGHYGAERVTVMNLEVVDVIPEENLLLVKGAVPGPNGGLVIVRE
TKKA

3D structure

• PDB: 6n1d Spontaneous ribosomal translocation of mRNA and tRNAs into a chimeric hybrid state.
• Chain: BL03
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BL03	M11 R13 P22 Q35 R37 K41 D42 Y44 K57 N60 R61 P62 G65 H66 K69 L78 R79 E80 R82 K109 G110 R111 G112 F113 G115 M117 K118 R119 N121 F122 A123 S128 H129 A131 H132 K133 I134 H135 R136 H137 P138 G139 S140 I141 G142 N143 R144 K145 T146 P147 G148 R149 V150 K152 K154 K155 M156 A157 H159 Y160 R164 T166 M168 N169 L170 G186 A187 V188 P189 P191 N192 K202 K203	M11 R13 P22 Q35 R37 K41 D42 Y44 K57 N60 R61 P62 G65 H66 K69 L78 R79 E80 R82 K109 G110 R111 G112 F113 G115 M117 K118 R119 N121 F122 A123 S128 H129 A131 H132 K133 I134 H135 R136 H137 P138 G139 S140 I141 G142 N143 R144 K145 T146 P147 G148 R149 V150 K152 K154 K155 M156 A157 H159 Y160 R164 T166 M168 N169 L170 G186 A187 V188 P189 P191 N192 K202 K203
BS02	MG	BL03	H137 P138 G139	H137 P138 G139

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6n1d, PDBe:6n1d, PDBj:6n1d
• PDBsum: 6n1d
• PubMed: 30936299
• UniProt: Q72I04|RL3_THET2 Large ribosomal subunit protein uL3 (Gene Name=rplC)