Structure of PDB 8q87 Chain BL

Receptor sequence

>8q87BL (length=208) Species: 9031 (Gallus gallus) [Search protein sequence]

APSRNGMILKPHFHKDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPV
AGPIRPIVRCPTVRYHKKVRAGRGFSLEELKLAGINKRFARTIGISVDPR
RRNKSTESLQANVQRLKEYRSKLILFPRKPSAPKKGDSSPEELKMATQLS
GPVMPIRNVFKREKARVISEEEKNFKAFASLRMARANARLFGIRAKRAKE
AAEQDVEK

3D structure

PDB

8q87 Structural insights into inactive ribosome complexes derived from cold-treated chick embryo cells

Chain

Resolution

2.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BL	A2 S4 R5 M8 L10 K11 P12 H13 F14 H15 K16 W18 Q19 W25 Q28 P29 R31 K32 I33 R35 R36 R39 Q40 R44 R56 V59 R60 C61 P62 T63 V64 Y66 H67 K68 K69 R71 G73 R74 L78 K82 K88 R92 D99 P100 R101 R102 R103 K105 S106 K130 K162 R163 K165 A166 K177 F179 R183 M184 R186 A187 R190 L191 G193 I194 R195 K197 R198	A1 S3 R4 M7 L9 K10 P11 H12 F13 H14 K15 W17 Q18 W24 Q27 P28 R30 K31 I32 R34 R35 R38 Q39 R43 R55 V58 R59 C60 P61 T62 V63 Y65 H66 K67 K68 R70 G72 R73 L77 K81 K87 R91 D98 P99 R100 R101 R102 K104 S105 K129 K161 R162 K164 A165 K176 F178 R182 M183 R185 A186 R189 L190 G192 I193 R194 K196 R197
BS02	rna	BL	F26 N27 A30 R34	F25 N26 A29 R33

External links

PDB	RCSB:8q87, PDBe:8q87, PDBj:8q87
PDBsum	8q87
PubMed
UniProt	P41125\|RL13_CHICK Large ribosomal subunit protein eL13 (Gene Name=RPL13)

[Back to BioLiP]