Structure of PDB 8jiw Chain BL

Receptor sequence

>8jiwBL (length=152) Species: 4565 (Triticum aestivum) [Search protein sequence]

AEQTEKAFLKQPKVFLCSKKTTKGNNKPGKEGNRFWKSVGLGFKTPKEAI
EGTYIDKKCPFTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHYVKKYQR
YEKRHSNIPAHISPCFRVREGDHVIIGQCRPLSKTVRFNVLKVVPAGSKS
GA

3D structure

PDB

8jiw Cryo-EM structure of wheat ribosome reveals unique features of the plant ribosomes.

Chain

Resolution

2.88 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BL	K7 P13 F16 K28 K31 E32 F36 K38 S39 V40 G41 L42 K59 S67 I68 R69 R71 S79 K81 M82 N83 I87 Y92 K98 Y99 R101 K104 R105 H106 S107 N108 Q129 R131 P132 L133 S134 K135 T136 R138 F139 S149 K150 S151	K6 P12 F15 K27 K30 E31 F35 K37 S38 V39 G40 L41 K58 S66 I67 R68 R70 S78 K80 M81 N82 I86 Y91 K97 Y98 R100 K103 R104 H105 S106 N107 Q128 R130 P131 L132 S133 K134 T135 R137 F138 S148 K149 S150

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8jiw, PDBe:8jiw, PDBj:8jiw
PDBsum	8jiw
PubMed	38458197
UniProt	A0A3B6QHW3

[Back to BioLiP]