Structure of PDB 8fiz Chain BL

Receptor sequence
>8fizBL (length=134) Species: 562 (Escherichia coli) [Search protein sequence]
YVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEKGLPIPV
VITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKISRAQLQ
EIAQTKAADMTGADIEAMTRSIEGTARSMGLVVE
3D structure
PDB8fiz A trailing ribosome speeds up RNA polymerase at the expense of transcript fidelity via force and allostery.
ChainBL
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna BL Q12 P22 P23 P26 A27 L28 Q30 A77 S90 G91 K92 P93 D116 M117 T118 R134 S135 M136 Q5 P15 P16 P19 A20 L21 Q23 A70 S83 G84 K85 P86 D109 M110 T111 R127 S128 M129
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006415 translational termination
GO:0015968 stringent response
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8fiz, PDBe:8fiz, PDBj:8fiz
PDBsum8fiz
PubMed36931247
UniProtP0A7J7|RL11_ECOLI Large ribosomal subunit protein uL11 (Gene Name=rplK)

[Back to BioLiP]