Structure of PDB 8c3a Chain BL

Receptor sequence

>8c3aBL (length=185) Species: 5476 (Candida albicans)

GRDHTSKQHVRSGHRTAPKSDNVYLQLLVKLYSFLARRTDAPFNKVILKS
LFLSKINRPPVSVSRISRALKQKGAAEKTIVVVGTVTDDNRLLEFPKATI
AALRFTAGAKDRILKNGGEAITLDQLALRAPKGQNTLIVRGPRNSREAVR
HFGFGPHKGKAPRILSKGRKFERARGRRRSRGFKV

3D structure

• PDB: 8c3a New crystal system to promote screening for new eukaryotic inhibitors
• Chain: BL
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BL	G2 R3 H5 Q9 H10 V11 R12 S13 G14 H15 R16 K20 S21 Q27 K31 F35 R38 R39 P43 F44 L54 S55 K56 I57 N58 P61 S65 R66 R69 K72 Q73 K79 T86 T88 D89 D90 N91 R92 R105 T107 A108 Q135 N136 T137 I139 R141 R144 N145 S146 R147 E148 R151 F153 P157 H158 K161 A162 P163 R164 S167 K168 R170 K171 F172 R174 R179 S181 R182 F184 K185	G1 R2 H4 Q8 H9 V10 R11 S12 G13 H14 R15 K19 S20 Q26 K30 F34 R37 R38 P42 F43 L53 S54 K55 I56 N57 P60 S64 R65 R68 K71 Q72 K78 T85 T87 D88 D89 N90 R91 R104 T106 A107 Q134 N135 T136 I138 R140 R143 N144 S145 R146 E147 R150 F152 P156 H157 K160 A161 P162 R163 S166 K167 R169 K170 F171 R173 R178 S180 R181 F183 K184

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0043232 intracellular non-membrane-bounded organelle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8c3a, PDBe:8c3a, PDBj:8c3a
• PDBsum: 8c3a
• UniProt: A0A8H6C4Y1