Structure of PDB 7nqh Chain BL

Receptor sequence

>7nqhBL (length=250) Species: 9606 (Homo sapiens)

DLILEVTAGVGGQEAMLFTSEIFDMYQQYAAFKRWHFETLEYFPSELGGL
RHASASIGGSEAYRHMKFEGGVHRVQRVPKTEKQGRVHTSTMTVAILPQP
TEINLVINPKDLRIDTKRASGAGGQHVNTTDSAVRIVHLPTGVVSECQQE
RSQLKNKELAMTKLRAKLYSMHLEEEINKRQNARKIQIGSKGRSEKIRTY
NFPQNRVTDHRINKTLHDLETFMQGDYLLDELVQSLKEYADYESLVEIIS

3D structure

• PDB: 7nqh Structural basis of translation termination, rescue, and recycling in mammalian mitochondria.
• Chain: BL
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BL	G111 V112 R153 R176 K185 Q186 G187 T191 K293 R295 S296 K298 Q306 R308	G9 V10 R51 R74 K83 Q84 G85 T89 K191 R193 S194 K196 Q204 R206
BS02	rna	BL	E148 G225 G226 Q227 E252 R253 K257	E46 G123 G124 Q125 E150 R151 K155
BS03	rna	BL	G113 Q115 Q178 G187 R188 V189 H190 T191	G11 Q13 Q76 G85 R86 V87 H88 T89
BS04	rna	BL	K219 R220 S222 G223 G225 G226 Q227 H228 V229 N230 T231 S234 R237 Q251 E252 R253 Q255 K265 Q283	K117 R118 S120 G121 G123 G124 Q125 H126 V127 N128 T129 S132 R135 Q149 E150 R151 Q153 K163 Q181

Gene Ontology

Molecular Function

• GO:0003747 translation release factor activity
• GO:0016149 translation release factor activity, codon specific

Biological Process

• GO:0006412 translation
• GO:0006415 translational termination
• GO:0070126 mitochondrial translational termination

Cellular Component

• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005759 mitochondrial matrix

External links

• PDB: RCSB:7nqh, PDBe:7nqh, PDBj:7nqh
• PDBsum: 7nqh
• PubMed: 33878294
• UniProt: Q9UGC7|RF1ML_HUMAN Peptide chain release factor 1-like, mitochondrial (Gene Name=MTRF1L)