Structure of PDB 6tb3 Chain BL

Receptor sequence
>6tb3BL (length=100) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
QKIAKTFTVDVSSPTENGVFDPASYAKYLIDHIKVEGAVGNLGNAVTVTE
DGTVVTVVSTAKFSGKYLKYLTKKYLKKNQLRDWIRFVSTKTNEYRLAFY
3D structure
PDB6tb3 The Ccr4-Not complex monitors the translating ribosome for codon optimality.
ChainBL
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BL K42 G45 K70 S72 G73 K74 Y75 K77 Y78 K81 K82 K85 K86 R90 R94 V96 S97 T100 N101 Y103 K34 G37 K62 S64 G65 K66 Y67 K69 Y70 K73 K74 K77 K78 R82 R86 V88 S89 T92 N93 Y95
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6tb3, PDBe:6tb3, PDBj:6tb3
PDBsum6tb3
PubMed32299921
UniProtP05749|RL22A_YEAST Large ribosomal subunit protein eL22A (Gene Name=RPL22A)

[Back to BioLiP]