Structure of PDB 4v8m Chain BL

Receptor sequence

>4v8mBL (length=169) [Search protein sequence]

ANPMREIVVKKLCINICVGESGDRLTRASKVLEQLCEQTPVLSRARLTVR
TFGIRRNEKIAVHCTVRGKKAEELLEKGLKVKEFELKSYNFSDTGSFGFG
ISEHIDLGIKYDPSTGIYGMDFYVVLGRRGERVAHRKRRVSRVGFNHRVR
KEEAMKWFEKVHDGIIFQA

3D structure

PDB

4v8m High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.

Chain

Resolution

5.57 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BL	N27 C29 G31 S55 R56 A57 R58 T63 F64 I66 I72 H75 Y101 N102 F103 S104 T106 G110 F111 G112 I113 G131 M132 D133 F134 Y135 K149	N15 C17 G19 S43 R44 A45 R46 T51 F52 I54 I60 H63 Y89 N90 F91 S92 T94 G98 F99 G100 I101 G119 M120 D121 F122 Y123 K137
BS02	rna	BL	P15 M16 R17 Q50 T51 T77 R79 R141 G142 R144 V145 H147 R148 R151 R154 G156 F157 N158 H159	P3 M4 R5 Q38 T39 T65 R67 R129 G130 R132 V133 H135 R136 R139 R142 G144 F145 N146 H147

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0006364	rRNA processing
GO:0006412	translation

	Cellular Component
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v8m, PDBe:4v8m, PDBj:4v8m
PDBsum	4v8m
PubMed	23395961
UniProt	Q38EI9

[Back to BioLiP]