Structure of PDB 4v6s Chain BL

Receptor sequence

>4v6sBL (length=103) Species: 562 (Escherichia coli) [Search protein sequence]

MQNQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFT
VLISPHVNKDARDQYEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQI
SLG

3D structure

PDB

4v6s Structural characterization of mRNA-tRNA translocation intermediates.

Chain

Resolution

13.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BL	M1 Q2 N3 Q4 R7 K11 R37 G38 P39 I40 L42 P43 T44 R45 K46 E47 R48 F49 T50 I53 S54 P55 H56 V57 N58 K59 R62 Q64 R68 H70 L71 R72 L73 D75 G103	M1 Q2 N3 Q4 R7 K11 R37 G38 P39 I40 L42 P43 T44 R45 K46 E47 R48 F49 T50 I53 S54 P55 H56 V57 N58 K59 R62 Q64 R68 H70 L71 R72 L73 D75 G103

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0001072	transcription antitermination factor activity, RNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0031564	transcription antitermination
GO:0032784	regulation of DNA-templated transcription elongation
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0008023	transcription elongation factor complex
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4v6s, PDBe:4v6s, PDBj:4v6s
PDBsum	4v6s
PubMed	22467828
UniProt	P0A7R5\|RS10_ECOLI Small ribosomal subunit protein uS10 (Gene Name=rpsJ)