Structure of PDB 4v5b Chain BL

Receptor sequence

>4v5bBL (length=123) Species: 199310 (Escherichia coli CFT073)

ATVNQLVRKPRARKVAKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRK
VCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGA
LDCSGVKDRKQARSKYGVKRPKA

3D structure

• PDB: 4v5b A Peptide Deformylase-Ribosome Complex Reveals Mechanism of Nascent Chain Processing.
• Chain: BL
• Resolution: 3.74 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BL	A1 N4 Q5 R11 A12 R13 A25 C26 P27 Q28 R30 K42 N45 S46 A47 L48 R49 T57 Y65 G67 G68 E69 R82 D88 R109 K110 Q111 A112 R113 S114 K115 Y116 V118 K119 R120	A1 N4 Q5 R11 A12 R13 A25 C26 P27 Q28 R30 K42 N45 S46 A47 L48 R49 T57 Y65 G67 G68 E69 R82 D88 R109 K110 Q111 A112 R113 S114 K115 Y116 V118 K119 R120

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v5b, PDBe:4v5b, PDBj:4v5b
• PDBsum: 4v5b
• PubMed: 18288106
• UniProt: P0A7S4|RS12_ECOL6 Small ribosomal subunit protein uS12 (Gene Name=rpsL)