Structure of PDB 4v4y Chain BL

Receptor sequence
>4v4yBL (length=138) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
KKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDA
IVPVEITIYADRSFTFVTKTPPASYLIRKAAGLEKGAHKPGREKVGRITW
EQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEVV
3D structure
PDB4v4y Structural basis for messenger RNA movement on the ribosome.
ChainBL
Resolution5.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BL Q11 P21 A26 Q29 H30 P73 A74 S75 Y76 R79 G87 H89 K90 P91 G92 R93 N116 T117 A122 R125 M126 S130 R132 S133 M134 Q10 P20 A25 Q28 H29 P72 A73 S74 Y75 R78 G86 H88 K89 P90 G91 R92 N115 T116 A121 R124 M125 S129 R131 S132 M133
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v4y, PDBe:4v4y, PDBj:4v4y
PDBsum4v4y
PubMed17051149
UniProtQ5SLP6|RL11_THET8 Large ribosomal subunit protein uL11 (Gene Name=rplK)

[Back to BioLiP]