Structure of PDB 4v4n Chain BL

Receptor sequence

>4v4nBL (length=102) Species: 2190 (Methanocaldococcus jannaschii)

MQKARIKIASTNVRSLDEVANQIKQIAERTGVRMSGPIPLPTKRIRITTR
KSPDGEGSATFDRWELRVHKRLIDIEADERAMRQIMRIRVPEDVTIEIEL
IS

3D structure

• PDB: 4v4n Structure of the SecY channel during initiation of protein translocation.
• Chain: BL
• Resolution: 9.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BL	R5 K7 R14 D17 S35 G36 P37 I38 P39 L40 P41 T42 R44 I45 R46 T48 R50 K51 P53 D54 G55 E56 G57 S58 R63 R67 H69 R71 E97	R5 K7 R14 D17 S35 G36 P37 I38 P39 L40 P41 T42 R44 I45 R46 T48 R50 K51 P53 D54 G55 E56 G57 S58 R63 R67 H69 R71 E97

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Mar 9 08:52:52 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v4n', asym_id = 'BL', title = 'Structure of the SecY channel during initiation of protein translocation.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v4n', asym_id='BL', title='Structure of the SecY channel during initiation of protein translocation.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003723,0003735,0005840,0006412,0015935', uniprot = '', pdbid = '4v4n', asym_id = 'BL'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0005840,0006412,0015935', uniprot='', pdbid='4v4n', asym_id='BL')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>