Structure of PDB 8ova Chain BK

Receptor sequence

>8ovaBK (length=194) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence]

ARRPARCYRFCKNKPYPKSRFCRGVPDPRIRTFDIGKRRAPVDEFPVCVH
VVSRELEQISSEALEAARIQANKYMVKRANKECFHMRIRAHPFHVLRINK
MLQTGMRQSYGKPNGTCARVRIGQILLSMRTKDTYVPQALESLRRAKMKF
PGRQIIVISKYWGFTNILRNEYEELRDAGKLQQRGLHVKLITPK

3D structure

PDB

8ova A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.

Chain

Resolution

2.47 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	BK	R4 K13 K15 P16 F22 D35 R39 R90 H92 F94 R98 S118 R193 G194 L195 H196	R3 K12 K14 P15 F21 D34 R38 R89 H91 F93 R97 S109 R184 G185 L186 H187
BS02	rna	BK	R4 A6 R7 E63 K74 Q112 G114 M115 R116 Q117 Y119 R154 K158 P160	R3 A5 R6 E62 K73 Q103 G105 M106 R107 Q108 Y110 R145 K149 P151
BS03	rna	BK	E56 L57 P202 K203	E55 L56 P193 K194

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ova, PDBe:8ova, PDBj:8ova
PDBsum	8ova
PubMed	37985661
UniProt	Q38EC5

[Back to BioLiP]