Structure of PDB 8oir Chain BK

Receptor sequence

>8oirBK (length=95) Species: 9606 (Homo sapiens) [Search protein sequence]

LTYFSARKGKRKTVKAVIDRFLRLHCGLWVRRKAGYKKKLWKKTPARKKR
LREFVFCNKTQSKLLDKMTTSFWKRRNWYVDDPYQKYHDRTNLKV

3D structure

PDB

8oir Molecular basis of translation termination at noncanonical stop codons in human mitochondria.

Chain

Resolution

3.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BK	L94 T95 Y96 F97 S98 A99 R100 K101 K103 R104 K105 T106 K108 R113 H118 R124 K126 A127 G128 K131 K132 L133 W134 K135 P138 A139 R140 K142 R143 L144 K152 T153 Q154 K156 K160 T163 F165 W166 R168 R169 D182	L1 T2 Y3 F4 S5 A6 R7 K8 K10 R11 K12 T13 K15 R20 H25 R31 K33 A34 G35 K38 K39 L40 W41 K42 P45 A46 R47 K49 R50 L51 K59 T60 Q61 K63 K67 T70 F72 W73 R75 R76 D89

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005761	mitochondrial ribosome
GO:0005762	mitochondrial large ribosomal subunit
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8oir, PDBe:8oir, PDBj:8oir
PDBsum	8oir
PubMed	37141370
UniProt	Q9NZE8\|RM35_HUMAN Large ribosomal subunit protein bL35m (Gene Name=MRPL35)