Structure of PDB 8evr Chain BK

Receptor sequence
>8evrBK (length=96) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
MLMPKEDRNKIHQYLFQEGVVVAKKDFNQAKHEEIDTKNLYVIKALQSLT
SKGYVKTQFSWQYYYYTLTEEGVEYLREYLNLPEHIVPGTYIQERN
3D structure
PDB8evr Regulation of translation by ribosomal RNA pseudouridylation.
ChainBK
Resolution2.87 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 A BK M1 N28 L40 K44 M1 N28 L40 K44
BS02 A BK S48 S51 S48 S51
BS03 U BK M3 K5 R8 M3 K5 R8
BS04 G BK F59 Y64 F59 Y64
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0000054 ribosomal subunit export from nucleus
GO:0002181 cytoplasmic translation
GO:0034198 cellular response to amino acid starvation
GO:0045860 positive regulation of protein kinase activity
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8evr, PDBe:8evr, PDBj:8evr
PDBsum8evr
PubMed37595043
UniProtQ08745|RS10A_YEAST Small ribosomal subunit protein eS10A (Gene Name=RPS10A)

[Back to BioLiP]