Structure of PDB 7zs5 Chain BK

Receptor sequence

>7zs5BK (length=220) Species: 4932 (Saccharomyces cerevisiae)

ARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVDEFPLCVH
LVSNELEQLSSEALEAARICANKYMTTVSGRDAFHLRVRVHPFHVLRINK
MLSCAGADRLQQGMRGAWGKPHGLAARVDIGQIIFSVRTKDSNKDVVVEG
LRRARYKFPGQQKIILSKKWGFTNLDRPEYLKKREAGEVKDDGAFVKFLS
KKGSLENNIREFPEYFAAQA

3D structure

• PDB: 7zs5 Structural basis for clearing of ribosome collisions by the RQT complex.
• Chain: BK
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BK	R2 R3 A5 R6 C7 R9 K12 K14 P15 Y21 R23 K39 E62 A66 R89 H91 F93 R97 L110 Q112 M114 R115 G116 A117 W118 R153 Y156 K157 P159 D192 G193 A194 F195 K197	R2 R3 A5 R6 C7 R9 K12 K14 P15 Y21 R23 K39 E62 A66 R89 H91 F93 R97 L110 Q112 M114 R115 G116 A117 W118 R153 Y156 K157 P159 D192 G193 A194 F195 K197
BS02	rna	BK	Y10 L56 K201 K202 G203 L205 E206	Y10 L56 K201 K202 G203 L205 E206
BS03	rna	BK	A24 D108 R109 Q112 K120	A24 D108 R109 Q112 K120

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0006415 translational termination

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7zs5, PDBe:7zs5, PDBj:7zs5
• PDBsum: 7zs5
• PubMed: 36801861
• UniProt: P41805|RL10_YEAST Large ribosomal subunit protein uL16 (Gene Name=RPL10)