Structure of PDB 7wg5 Chain BK

Receptor sequence
>7wg5BK (length=64) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]
DFIGSSTNLIMVTSTTLMLFAGRFGLALQTGDPAGFTLADTLACGTVGHI
IGVGVVLGLKNIGA
3D structure
PDB7wg5 Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana.
ChainBK
Resolution3.89 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA BK G96 D97 F101 T102 T106 G31 D32 F36 T37 T41
BS02 CLA BK I115 I116 G119 V120 N126 I50 I51 G54 V55 N61
BS03 CLA BK D47 H114 D1 H49
Gene Ontology
Cellular Component
GO:0005634 nucleus
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009534 chloroplast thylakoid
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7wg5, PDBe:7wg5, PDBj:7wg5
PDBsum7wg5
PubMed35123031
UniProtQ9SUI5|PSAK_ARATH Photosystem I reaction center subunit psaK, chloroplastic (Gene Name=PSAK)

[Back to BioLiP]