Structure of PDB 6i7v Chain BK

Receptor sequence
>6i7vBK (length=117) Species: 562 (Escherichia coli) [Search protein sequence]
RKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFA
AQVAAERCADAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITD
VTPIPHNGCRPPKKRRV
3D structure
PDB6i7v Bacterial ribosome heterogeneity: Changes in ribosomal protein composition during transition into stationary growth phase.
ChainBK
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna BK H22 N28 N29 I31 G39 N40 A41 W44 T46 G48 R53 G54 S55 K57 P115 H118 N119 G120 C121 R122 P123 P124 K125 R127 R128 H10 N16 N17 I19 G27 N28 A29 W32 T34 G36 R41 G42 S43 K45 P103 H106 N107 G108 C109 R110 P111 P112 K113 R115 R116
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6i7v, PDBe:6i7v, PDBj:6i7v
PDBsum6i7v
PubMed30359641
UniProtP0A7R9|RS11_ECOLI Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]