Structure of PDB 6eri Chain BK

Receptor sequence
>6eriBK (length=110) Species: 3562 (Spinacia oleracea) [Search protein sequence]
VIHVQASFNNTIVTVTDVRGRVVSWASAGTCGFRGTKRGTPFAAQTAAGN
AIRTVVEQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHN
GCRPPKKRRV
3D structure
PDB6eri Structure of the chloroplast ribosome with chl-RRF and hibernation-promoting factor.
ChainBK
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BK H31 Q33 N37 N38 T42 G48 R49 V50 W53 S55 G57 T58 G63 T64 R66 K96 M125 P126 H127 N128 G129 C130 R131 P133 K134 R136 R137 V138 H3 Q5 N9 N10 T14 G20 R21 V22 W25 S27 G29 T30 G35 T36 R38 K68 M97 P98 H99 N100 G101 C102 R103 P105 K106 R108 R109 V110
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6eri, PDBe:6eri, PDBj:6eri
PDBsum6eri
PubMed29610536
UniProtP06506|RR11_SPIOL Small ribosomal subunit protein uS11c (Gene Name=rps11)

[Back to BioLiP]