Structure of PDB 4v92 Chain BK |
>4v92BK (length=93) Species: 28985 (Kluyveromyces lactis) [Search protein sequence] |
MLMPKEDRNKIHQYLFQEGVVVAKADFNQAAHEEIDTKNLYVIKALQSLT SKGYVKTQFSWQYYYYTLTEEGVEYLREYLNLPEHIVPGTYIQ |
|
PDB | 4v92 Initiation of Translation by Cricket Paralysis Virus Ires Requires its Translocation in the Ribosome. |
Chain | BK |
Resolution | 3.7 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
BK |
L2 F27 |
L2 F27 |
|
|
|