Structure of PDB 4v8m Chain BK

Receptor sequence

>4v8mBK (length=212) [Search protein sequence]

ARRPARCYRFCKNKPYPKSRFCRGVPDPRIRTFDIGKRRAPVDEFPVCVH
VVSRELEQISSEALEAARIQANKYMVKRANKECFHMRIRAHPFHVLRINK
MLSCAGADRLQTGMRQSYGKPNGTCARVRIGQILLSMRTKDTYVPQALES
LRRAKMKFPGRQIIVISKYWGFTNILRNEYEELRDAGKLQQRGLHVKLIT
PKGKITPYNIMA

3D structure

PDB

4v8m High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.

Chain

Resolution

5.57 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	BK	R4 C8 Y9 K13 N14 K15 P16 K19 R21 F22 R39 R40 R88 R90 H92 F94 R98 I99 N100 Y119 G120 Q133 R193 G194 L195 H196 K198	R3 C7 Y8 K12 N13 K14 P15 K18 R20 F21 R38 R39 R87 R89 H91 F93 R97 I98 N99 Y118 G119 Q132 R192 G193 L194 H195 K197
BS02	rna	BK	A2 R3 R4 A6 R7 K15 F22 R24 E63 A64 Q71 K74 K78 R110 L111 G114 M115 R116 Q117 Y119 R154 M157 K158 F159 P160	A1 R2 R3 A5 R6 K14 F21 R23 E62 A63 Q70 K73 K77 R109 L110 G113 M114 R115 Q116 Y118 R153 M156 K157 F158 P159
BS03	rna	BK	R55 R162 K203 G204 K205 I206 T207	R54 R161 K202 G203 K204 I205 T206

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v8m, PDBe:4v8m, PDBj:4v8m
PDBsum	4v8m
PubMed	23395961
UniProt	Q38EC5

[Back to BioLiP]