Structure of PDB 4v82 Chain BK

Receptor sequence
>4v82BK (length=37) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR
3D structure
PDB4v82 Structural basis of cyanobacterial photosystem II Inhibition by the herbicide terbutryn
ChainBK
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide BK P5020 V5024 L5035 P11 V15 L26
BS02 CLA BK P5029 V5030 L5033 P20 V21 L24
BS03 CLA BK F5037 W5039 Q5040 F28 W30 Q31
BS04 CA BK D5019 D5023 D10 D14
Gene Ontology
Cellular Component
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v82, PDBe:4v82, PDBj:4v82
PDBsum4v82
PubMed21367867
UniProtQ9F1K9|PSBK_THEVB Photosystem II reaction center protein K (Gene Name=psbK)

[Back to BioLiP]