Structure of PDB 4v7i Chain BK

Receptor sequence

>4v7iBK (length=117) Species: 83333 (Escherichia coli K-12) [Search protein sequence]

RKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFA
AQVAAERCADAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITD
VTPIPHNGCRPPKKRRV

3D structure

PDB

4v7i Regulation of the protein-conducting channel by a bound ribosome.

Chain

Resolution

9.6 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BK	H21 N27 N28 I30 T32 Q37 G38 N39 A40 L41 W43 G53 S54 K56 K86 P114 I115 P116 H117 N118 G119 C120 R121 P122 K124 K125 R126 R127 V128	H10 N16 N17 I19 T21 Q26 G27 N28 A29 L30 W32 G42 S43 K45 K75 P103 I104 P105 H106 N107 G108 C109 R110 P111 K113 K114 R115 R116 V117

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding
GO:0070181	small ribosomal subunit rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4v7i, PDBe:4v7i, PDBj:4v7i
PDBsum	4v7i
PubMed	19913480
UniProt	P0A7R9\|RS11_ECOLI Small ribosomal subunit protein uS11 (Gene Name=rpsK)