Structure of PDB 4v6s Chain BK

Receptor sequence

>4v6sBK (length=129) Species: 562 (Escherichia coli) [Search protein sequence]

AENQYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQP
LELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKA
GFVTRDARQVERKKVGLRKARRRPQFSKR

3D structure

PDB

4v6s Structural characterization of mRNA-tRNA translocation intermediates.

Chain

Resolution

13.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BK	N3 Q4 Y6 T8 R10 R11 K12 R17 F19 R32 Y37 G39 R40 Y63 K67 G68 G69 G70 I71 Q74 R84 R98 K99 T104 R105 D106 R108 Q109 V110 E111 R112 K113 K114 L117 R118 K119 A120 R121 R122 R123 Q125 F126 S127 K128 R129	N3 Q4 Y6 T8 R10 R11 K12 R17 F19 R32 Y37 G39 R40 Y63 K67 G68 G69 G70 I71 Q74 R84 R98 K99 T104 R105 D106 R108 Q109 V110 E111 R112 K113 K114 L117 R118 K119 A120 R121 R122 R123 Q125 F126 S127 K128 R129

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4v6s, PDBe:4v6s, PDBj:4v6s
PDBsum	4v6s
PubMed	22467828
UniProt	P0A7X3\|RS9_ECOLI Small ribosomal subunit protein uS9 (Gene Name=rpsI)