Structure of PDB 4v6k Chain BK

Receptor sequence

>4v6kBK (length=178) Species: 83333 (Escherichia coli K-12)

PRRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAESIVYSALETLA
QRSGKSELEAFEVALENVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAM
RWIVEAARKRGDKSMALRLANELSDAAENKGTAVKKREDVHRMAEANKAF
AHYRWLSLRSFSHQAGASSKQPALGYLN

3D structure

• PDB: 4v6k Structural insights into cognate versus near-cognate discrimination during decoding.
• Chain: BK
• Resolution: 8.25 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BK	P1 R2 R3 R4 I6 G7 Q8 R9 K24 N27 L29 M30 D32 G33 K34 K35 S36 T37 I41 R77 R78 V79 R91 R94 K109 K113 S114 M115 R118 S157 L158 R159	P1 R2 R3 R4 I6 G7 Q8 R9 K24 N27 L29 M30 D32 G33 K34 K35 S36 T37 I41 R77 R78 V79 R91 R94 K109 K113 S114 M115 R118 S157 L158 R159
BS02	rna	BK	V79 G81 Y84 A151 W155 S157 L158 S160 F161 S162 G166 A167	V79 G81 Y84 A151 W155 S157 L158 S160 F161 S162 G166 A167

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0019843 rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0017148 negative regulation of translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0016020 membrane
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v6k, PDBe:4v6k, PDBj:4v6k
• PDBsum: 4v6k
• PubMed: 21378755
• UniProt: P02359|RS7_ECOLI Small ribosomal subunit protein uS7 (Gene Name=rpsG)