Structure of PDB 4v6i Chain BK

Receptor sequence

>4v6iBK (length=199) Species: 4932 (Saccharomyces cerevisiae)

MSVEPVVVIDGKGHLVGRLASVVAKQLLNGQKIVVVRAEELNISGEFFRN
KLKYHDFLRKATAFNKTRGPFHFRAPSRIFYKALRGMVSHKTARGKAALE
RLKVFEGIPPPYDKKKRVVVPQALRVLRLKPGRKYTTLGKLSTSVGWKYE
DVVAKLEAKRKVSSAEYYAKKRAFTKKVASANATAAESDVAKQLAALGY

3D structure

• PDB: 4v6i Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.
• Chain: BK
• Resolution: 8.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BK	L15 G17 R18 S21 I43 S44 G45 R49 K53 D56 F57 K60 A61 T62 A63 F64 R68 G69 F71 R74 R78 K82 A83 R85 G86 M87 S89 H90 K91 T92 A93 K96 E100 P111 K130 R133 K134 W147 K159 V162 T175	L15 G17 R18 S21 I43 S44 G45 R49 K53 D56 F57 K60 A61 T62 A63 F64 R68 G69 F71 R74 R78 K82 A83 R85 G86 M87 S89 H90 K91 T92 A93 K96 E100 P111 K130 R133 K134 W147 K159 V162 T175

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000470 maturation of LSU-rRNA
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0017148 negative regulation of translation

Cellular Component

• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v6i, PDBe:4v6i, PDBj:4v6i
• PDBsum: 4v6i
• PubMed: 20980660
• UniProt: P26784|RL16A_YEAST Large ribosomal subunit protein uL13A (Gene Name=RPL16A)