Structure of PDB 4v67 Chain BK

Receptor sequence
>4v67BK (length=147) Species: 274 (Thermus thermophilus) [Search protein sequence]
MKKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGD
AIVPVEITIYADRSFTFVTKTPPASYLIRKAAGLEKGAHKPGREKVGRIT
WEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEVVGAPEVKDA
3D structure
PDB4v67 Crystal structure of a translation termination complex formed with release factor RF2.
ChainBK
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BK K9 Q11 P54 P73 K86 G87 A88 H89 K90 P91 R93 K111 N116 T117 T118 A122 R125 M126 G129 R132 S133 M134 K9 Q11 P54 P73 K86 G87 A88 H89 K90 P91 R93 K111 N116 T117 T118 A122 R125 M126 G129 R132 S133 M134
BS02 MG BK V5 R63 V5 R63
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v67, PDBe:4v67, PDBj:4v67
PDBsum4v67
PubMed19064930
UniProtQ5SLP6|RL11_THET8 Large ribosomal subunit protein uL11 (Gene Name=rplK)

[Back to BioLiP]