Structure of PDB 4v62 Chain BK

Receptor sequence
>4v62BK (length=37) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR
3D structure
PDB4v62 Cyanobacterial photosystem II at 2.9-A resolution and the role of quinones, lipids, channels and chloride
ChainBK
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide BK P20 D23 V24 I28 L35 P11 D14 V15 I19 L26
BS02 CLA BK P29 L33 P20 L24
BS03 CLA BK F37 W39 Q40 F28 W30 Q31
BS04 CA BK D19 D23 D10 D14
Gene Ontology
Cellular Component
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v62, PDBe:4v62, PDBj:4v62
PDBsum4v62
PubMed19219048
UniProtQ9F1K9|PSBK_THEVB Photosystem II reaction center protein K (Gene Name=psbK)

[Back to BioLiP]