Structure of PDB 4v4t Chain BK

Receptor sequence
>4v4tBK (length=133) Species: 274 (Thermus thermophilus) [Search protein sequence]
QIKLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETADKAGMILPVV
ITVYEDKSFTFIIKTPPASFLLKKAAGIEKGSSEPKRKIVGKVTRKQIEE
IAKTKMPDLNANSLEAAMKIIEGTAKSMGIEVV
3D structure
PDB4v4t Crystal Structures of the Ribosome in Complex with Release Factors RF1 and RF2 Bound to a Cognate Stop Codon.
ChainBK
Resolution6.46 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BK I9 K10 Q12 H31 P73 P74 S76 F77 K87 G88 S90 E91 P92 K93 R94 K112 D115 L116 N117 A118 A123 K126 I127 E129 G130 K133 S134 M135 I2 K3 Q5 H24 P66 P67 S69 F70 K80 G81 S83 E84 P85 K86 R87 K105 D108 L109 N110 A111 A116 K119 I120 E122 G123 K126 S127 M128
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v4t, PDBe:4v4t, PDBj:4v4t
PDBsum4v4t
PubMed16377566
UniProtP29395|RL11_THEMA Large ribosomal subunit protein uL11 (Gene Name=rplK)

[Back to BioLiP]