Structure of PDB 8oit Chain BJ

Receptor sequence
>8oitBJ (length=46) Species: 9606 (Homo sapiens) [Search protein sequence]
KARGNEYQPSNIKRKNKHGWVRRLSTPAGVQVILRRMLKGRKSLSH
3D structure
PDB8oit Molecular basis of translation termination at noncanonical stop codons in human mitochondria.
ChainBJ
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BJ K47 A48 R49 G50 N51 E52 Y53 Q54 P55 S56 N57 K59 R60 K61 N62 K63 H64 G65 W66 V67 R69 A74 V78 R81 R82 K85 G86 R87 K88 H92 K1 A2 R3 G4 N5 E6 Y7 Q8 P9 S10 N11 K13 R14 K15 N16 K17 H18 G19 W20 V21 R23 A28 V32 R35 R36 K39 G40 R41 K42 H46
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005761 mitochondrial ribosome
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8oit, PDBe:8oit, PDBj:8oit
PDBsum8oit
PubMed37141370
UniProtQ9BQ48|RM34_HUMAN Large ribosomal subunit protein bL34m (Gene Name=MRPL34)

[Back to BioLiP]