Structure of PDB 8cre Chain BJ

Receptor sequence

>8creBJ (length=199) Species: 5476 (Candida albicans) [Search protein sequence]

SSFEKVVVIDGKGHLLGRLASIVSKQILNGQKVVVVRCEELNISGEFFRN
KLKYHDYLRKATRYNKKKGPFHFRAPSRILYKAIRGMIPHKTARGKAALE
RLKVFEGVPPPYDKKKRVVVPQALRVLRLKPGRKYTTVGKLSSAVGWKYE
SVVEKLEEKRKVQSAEYYAKKKALTKKLNAAKASTAESEAAQKLAAFGY

3D structure

PDB

8cre Drug-induced rotational movement of the ribosome is a key factor for read-through enhancement

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BJ	K6 V7 V9 K13 G18 R19 S22 K26 L29 K33 R38 S45 F49 R50 R60 K61 A62 T63 R64 Y65 N66 K67 P71 F72 H73 F74 R75 K83 A84 R86 G87 M88 P90 H91 K92 T93 A94 R95 R102 F106 G108 V109 P110 P111 Y113 D114 K115 K116 K117 R118 Q123 R129 L130 K131 P132 R134 K135 G147 K149 Y150 L157 E158 K160 R161 K162 S165 Y168 Y169 K172 K173	K5 V6 V8 K12 G17 R18 S21 K25 L28 K32 R37 S44 F48 R49 R59 K60 A61 T62 R63 Y64 N65 K66 P70 F71 H72 F73 R74 K82 A83 R85 G86 M87 P89 H90 K91 T92 A93 R94 R101 F105 G107 V108 P109 P110 Y112 D113 K114 K115 K116 R117 Q122 R128 L129 K130 P131 R133 K134 G146 K148 Y149 L156 E157 K159 R160 K161 S164 Y167 Y168 K171 K172
BS02	MG	BJ	G87 H91	G86 H90

External links

PDB	RCSB:8cre, PDBe:8cre, PDBj:8cre
PDBsum	8cre
PubMed
UniProt	A0A8H6BZ56

[Back to BioLiP]