Structure of PDB 6th6 Chain BJ

Receptor sequence

>6th6BJ (length=168) Species: 69014 (Thermococcus kodakarensis KOD1) [Search protein sequence]

LRPAKIDRDVDKPAYTRREYIRGAPGPKITIFDMGNLSAEFEYEVSLHAE
QAMQIRQNALEAIRIQVNRYLQKNVGRSNYHFKIRVYPFQVLRENPMNGM
RRPFGKPIGLAARVRKDQKILTVWVNGQHLKFALGAMHRAKMKLPYSAYY
RIYDKEGNDVTTKVLSTM

3D structure

PDB

6th6 Dynamic RNA acetylation revealed by quantitative cross-evolutionary mapping.

Chain

Resolution

2.55 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BJ	A6 K7 R10 T18 R19 E21 Y22 R24 D35 L39 R58 A61 Q68 R87 Y89 F91 R95 N97 M112 R113 R114 P115 F116 Q130 R151 M154 K155 L156 P157 S178	A4 K5 R8 T16 R17 E19 Y20 R22 D33 L37 R56 A59 Q66 R85 Y87 F89 R93 N95 M100 R101 R102 P103 F104 Q118 R139 M142 K143 L144 P145 S166

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6th6, PDBe:6th6, PDBj:6th6
PDBsum	6th6
PubMed	32555463
UniProt	Q5JDI6\|RL10E_THEKO Large ribosomal subunit protein uL16 (Gene Name=rpl10e)

[Back to BioLiP]