Structure of PDB 6tb3 Chain BJ

Receptor sequence

>6tb3BJ (length=159) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

GKSHGYRSRTRYMFQRDFRKHGAVHLSTYLKVYKVGDIVDIKANGSIQKG
MPHKFYQGKTGVVYNVTKSSVGVIINKMVGNRYLEKRLNLRVEHIKHSKC
RQEFLERVKANAAKRAEAKAQGVAVQLKRQPAQPRESRIVSTEGNVPQTL
APVPYETFI

3D structure

PDB

6tb3 The Ccr4-Not complex monitors the translating ribosome for codon optimality.

Chain

Resolution

2.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BJ	G2 K3 S4 H5 G6 Y7 R8 S9 R10 R12 Y13 M14 F15 Q16 R17 F19 H22 G23 K35 D41 K43 G46 S47 Q49 K50 G51 H54 K55 Y57 G59 T61 T68 K69 S70 S71 K78 V80 R83 L85 K87 R88 L89 N90 R92 K97 K100 C101 F105 R108 V109 R116 Q127 L128 K129 R130	G1 K2 S3 H4 G5 Y6 R7 S8 R9 R11 Y12 M13 F14 Q15 R16 F18 H21 G22 K34 D40 K42 G45 S46 Q48 K49 G50 H53 K54 Y56 G58 T60 T67 K68 S69 S70 K77 V79 R82 L84 K86 R87 L88 N89 R91 K96 K99 C100 F104 R107 V108 R115 Q126 L127 K128 R129
BS02	rna	BJ	H26 L27 S28	H25 L26 S27

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6tb3, PDBe:6tb3, PDBj:6tb3
PDBsum	6tb3
PubMed	32299921
UniProt	Q02753\|RL21A_YEAST Large ribosomal subunit protein eL21A (Gene Name=RPL21A)

[Back to BioLiP]