Structure of PDB 4v8z Chain BJ

Receptor sequence

>4v8zBJ (length=169) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

QNPMRDLKIEKLVLNISVGESGDRLTRASKVLEQLSGQTPVQSKARYTVR
TFGIRRNEKIAVHVTVRGPKAEEILERGLKVKEYQLRDRNFSATGNFGFG
IDEHIDLGIKYDPSIGIFGMDFYVVMNRPGARVTRRKRCKGTVGNSHKTT
KEDTVSWFKQKYDADVLDK

3D structure

PDB

4v8z Molecular architecture of a eukaryotic translational initiation complex.

Chain

Resolution

6.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BJ	K16 V18 N20 S22 G24 S48 R51 Y52 F57 H68 R94 N95 F96 S97 A98 T99 N101 G103 F104 G105 I106 D107 G124 M125 D126 Y128 V130 K142	K11 V13 N15 S17 G19 S43 R46 Y47 F52 H63 R89 N90 F91 S92 A93 T94 N96 G98 F99 G100 I101 D102 G119 M120 D121 Y123 V125 K137
BS02	rna	BJ	Q43 T70 R72 G135 R137 R140 R141 N150	Q38 T65 R67 G130 R132 R135 R136 N145

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v8z, PDBe:4v8z, PDBj:4v8z
PDBsum	4v8z
PubMed	24200810
UniProt	P0C0W9\|RL11A_YEAST Large ribosomal subunit protein uL5A (Gene Name=RPL11A)

[Back to BioLiP]