Structure of PDB 4v7p Chain BJ

Receptor sequence

>4v7pBJ (length=137) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]

KTYVPKQVEPRWVLIDAEGKTLGRLATKIATLLRGKHRPDWTPNVAMGDF
VVVVNADKIRVTGKKLEQKIYTRYSGYPGGLKKIPLEKMLATHPERVLEH
AVKGMLPKGPLGRRLFKRLKVYAGPDHPHQAQRPEKL

3D structure

PDB

4v7p Recognition of the amber UAG stop codon by release factor RF1.

Chain

Resolution

3.62 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BJ	K25 T26 V28 W36 T45 L46 G47 R48 T51 T55 K60 N68 F74 T86 K89 Q92 K93 T96 Y98 S99 Y101 G103 L105 K106 K112 H117 H124 A125 M129 K132 G133 P134 L135 R137 K141	K1 T2 V4 W12 T21 L22 G23 R24 T27 T31 K36 N44 F50 T62 K65 Q68 K69 T72 Y74 S75 Y77 G79 L81 K82 K88 H93 H100 A101 M105 K108 G109 P110 L111 R113 K117

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0017148	negative regulation of translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4v7p, PDBe:4v7p, PDBj:4v7p
PDBsum	4v7p
PubMed	20588254
UniProt	Q72IN1\|RL13_THET2 Large ribosomal subunit protein uL13 (Gene Name=rplM)