Structure of PDB 4v7j Chain BJ |
>4v7jBJ (length=130) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] |
KRNVELLATLKENLERAQGSFFLVNYQGLPAKETHALRQALKQNGARLFV AKNTLIRLALKELGLPELDGLQGPSAVVFYEDPVAAAKTLVQFAKSNPKG IPQVKSGLLQGQILTAKDVEALAELPTMDE |
|
PDB | 4v7j The structural basis for mRNA recognition and cleavage by the ribosome-dependent endonuclease RelE. |
Chain | BJ |
Resolution | 3.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
BJ |
N6 L10 V80 V81 |
N3 L7 V77 V78 |
|
|
|
|