Structure of PDB 4v7i Chain BJ

Receptor sequence

>4v7iBJ (length=98) Species: 83333 (Escherichia coli K-12) [Search protein sequence]

RIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLIS
PHVNKDARDQYEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISL

3D structure

PDB

4v7i Regulation of the protein-conducting channel by a bound ribosome.

Chain

Resolution

9.6 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BJ	R5 R7 R9 H15 R37 G38 P39 I40 P41 L42 P43 T44 R45 K46 R48 F49 T50 L52 I53 S54 P55 H56 V57 N58 D60 A61 R62 Q64 R68 H70 R72 L73 D75 Q99 S101 L102	R1 R3 R5 H11 R33 G34 P35 I36 P37 L38 P39 T40 R41 K42 R44 F45 T46 L48 I49 S50 P51 H52 V53 N54 D56 A57 R58 Q60 R64 H66 R68 L69 D71 Q95 S97 L98

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0001072	transcription antitermination factor activity, RNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0031564	transcription antitermination
GO:0032784	regulation of DNA-templated transcription elongation
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0008023	transcription elongation factor complex
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4v7i, PDBe:4v7i, PDBj:4v7i
PDBsum	4v7i
PubMed	19913480
UniProt	P0A7R5\|RS10_ECOLI Small ribosomal subunit protein uS10 (Gene Name=rpsJ)