Structure of PDB 4v6u Chain BJ

Receptor sequence

>4v6uBJ (length=132) Species: 186497 (Pyrococcus furiosus DSM 3638) [Search protein sequence]

RGVSAVRPTRALPVGAYLTVADNSGAKVIQIIGVVEYHGTRRRLASAGVG
DMVVATVKKGRPDMRHQVVRAVIIRQRKEYRRLDGMRVKFEDNAAVIVTP
EGVPRGTEIRGPVAREAAERWVRIGSIASIIV

3D structure

PDB

4v6u Promiscuous behaviour of archaeal ribosomal proteins: Implications for eukaryotic ribosome evolution.

Chain

Resolution

6.6 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BJ	R70 R74 R119	R61 R65 R110
BS02	rna	BJ	G11 V12 R16 P17 R19 A20 P22 A25 Y26 I41 V44 E45 Y46 H47 G48 T49 R50 R51 R52 L53 V63 T65 H75 R79 R86 K87 E88 R96 N102	G2 V3 R7 P8 R10 A11 P13 A16 Y17 I32 V35 E36 Y37 H38 G39 T40 R41 R42 R43 L44 V54 T56 H66 R70 R77 K78 E79 R87 N93

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding
GO:0070180	large ribosomal subunit rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4v6u, PDBe:4v6u, PDBj:4v6u
PDBsum	4v6u
PubMed	23222135
UniProt	Q8U009\|RL14_PYRFU Large ribosomal subunit protein uL14 (Gene Name=rpl14)