Structure of PDB 4v6l Chain BJ

Receptor sequence

>4v6lBJ (length=141) Species: 83333 (Escherichia coli K-12) [Search protein sequence]

AKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEK
GLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKI
SRAQLQEIAQTKAADMTGADIEAMTRSIEGTARSMGLVVED

3D structure

PDB

4v6l Structural insights into cognate versus near-cognate discrimination during decoding.

Chain

Resolution

13.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BJ	Q5 Y7 V8 K9 L10 Q11 P21 P22 P25 A26 Q29 A76 K80 S87 G88 G90 K91 P92 N93 K94 K112 M116 T117 G118 A123 R126 S127 E129 G130 T131 S134 M135	Q5 Y7 V8 K9 L10 Q11 P21 P22 P25 A26 Q29 A76 K80 S87 G88 G90 K91 P92 N93 K94 K112 M116 T117 G118 A123 R126 S127 E129 G130 T131 S134 M135

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding
GO:0070180	large ribosomal subunit rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0006415	translational termination
GO:0015968	stringent response

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4v6l, PDBe:4v6l, PDBj:4v6l
PDBsum	4v6l
PubMed	21378755
UniProt	P0A7J7\|RL11_ECOLI Large ribosomal subunit protein uL11 (Gene Name=rplK)