Structure of PDB 4v49 Chain BJ

Receptor sequence
>4v49BJ (length=141) Species: 562 (Escherichia coli) [Search protein sequence]
HDLKPTPGSRKDRKRVGRGPGGTDKTAGRGHKGQKSRSGAGKGAFFEGGR
SRLIARLPKRGFNNVGTTYEVVKLSQLQDLEDTTFDRDTLEAYRLVRRKN
RPVKLLASGEISRAVTVHVDAASAAAIKAVEAAGGRVVLPE
3D structure
PDB4v49 X-ray Crystal Structures of the WT and a Hyper-Accurate Ribosome From Escherichia Coli
ChainBJ
Resolution8.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna BJ T26 G33 G46 L60 S126 T23 G30 G43 L57 S123
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Tue Dec 3 05:11:52 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v49', asym_id = 'BJ', title = 'X-ray Crystal Structures of the WT and a Hyper-Accurate Ribosome From Escherichia Coli'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v49', asym_id='BJ', title='X-ray Crystal Structures of the WT and a Hyper-Accurate Ribosome From Escherichia Coli')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412,0015934', uniprot = '', pdbid = '4v49', asym_id = 'BJ'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0015934', uniprot='', pdbid='4v49', asym_id='BJ')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>