Structure of PDB 8ove Chain BI

Receptor sequence

>8oveBI (length=191) Species: 5702 (Trypanosoma brucei brucei)

GVDLTGVQKKKRVVRHHTYSTNPYIKLLIKLYKFLGKRTNSPFNKLIHKR
LLKSRNNRAPISLSRIAVCMRRRTVWLKKGKKSPIAVIVGDVLDDVRMTR
IPALRICALRFSKSARERITGAGGECLTFDQLAMMAPTGKNTMLLRGRKS
GRESVKHFGAAGVPGSHAKPHVSSRGKERQRSSKRRHAFRH

3D structure

• PDB: 8ove A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
• Chain: BI
• Resolution: 2.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BI	G2 Q9 K10 K11 K12 R13 R16 H17 H18 Y20 S21 K31 K34 F35 P43 K54 S55 R56 N57 S63 S65 R66 R72 R73 R74 W77 L94 D95 D96 V97 R98 M99 R101 P103 R111 S113 K114 S115 K141 N142 L146 R147 R149 S151 S155 F159 H168 K170 S175 R176 G177 R180 R187 A189	G1 Q8 K9 K10 K11 R12 R15 H16 H17 Y19 S20 K30 K33 F34 P42 K53 S54 R55 N56 S62 S64 R65 R71 R72 R73 W76 L93 D94 D95 V96 R97 M98 R100 P102 R110 S112 K113 S114 K140 N141 L145 R146 R148 S150 S154 F158 H167 K169 S174 R175 G176 R179 R186 A188
BS02	rna	BI	R182 S183 S184 K185 H192	R181 S182 S183 K184 H191

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0043232 intracellular non-membrane-bounded organelle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8ove, PDBe:8ove, PDBj:8ove
• PDBsum: 8ove
• PubMed: 37985661
• UniProt: P50885|RL18_TRYB2 Large ribosomal subunit protein eL18 (Gene Name=RPL18-A)