Structure of PDB 8oeq Chain BI

Receptor sequence

>8oeqBI (length=203) Species: 5476 (Candida albicans) [Search protein sequence]

GAYKYLEELQRKKQSDVMRFLYRVRCWEYRQKNVIHRASRPSRPDKARRL
GYKAKQGFVIYRIRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQKSLRST
AEERVGRRASNLRVLNSYWVNQDSTYKYFEVILVDPSHKAIRRDARYNWI
VNPVHKHREARGLTSAGKKSRGINKGHLFNKTKAGRRHTWKKHNTLSLWR
YRS

3D structure

PDB

8oeq Drug-induced rotational movement of the ribosome is a key factor for read-through enhancement

Chain

Resolution

3.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	BI	G2 Y4 K5 E8 R12 K13 K14 Q15 R20 R24 W28 R31 N34 V35 S40 R41 R44 K47 R49 R50 L51 K54 A55 K56 Q57 R67 R68 G69 G70 R71 K72 R73 P74 P76 K77 G78 Y81 G82 K83 P84 T85 N86 Q87 N90 Q91 K93 Y94 Q95 K96 S97 L98 R105 S111 N112 N117 W120 S125 Y127 S138 H139 R144 R147 W150 P154 V155 H156 K157 R159 A161 R162 L164 S166 K169 K170 S171 R172 I174 K176 G177 H178 L179 F180 N181 K182 R187 R188 H189 W191 K192 K193 H194 S198 W200 R201 Y202 R203	G1 Y3 K4 E7 R11 K12 K13 Q14 R19 R23 W27 R30 N33 V34 S39 R40 R43 K46 R48 R49 L50 K53 A54 K55 Q56 R66 R67 G68 G69 R70 K71 R72 P73 P75 K76 G77 Y80 G81 K82 P83 T84 N85 Q86 N89 Q90 K92 Y93 Q94 K95 S96 L97 R104 S110 N111 N116 W119 S124 Y126 S137 H138 R143 R146 W149 P153 V154 H155 K156 R158 A160 R161 L163 S165 K168 K169 S170 R171 I173 K175 G176 H177 L178 F179 N180 K181 R186 R187 H188 W190 K191 K192 H193 S197 W199 R200 Y201 R202
BS02	rna	BI	R38 V60 Y62 R109 N112 D136 H139	R37 V59 Y61 R108 N111 D135 H138
BS03	MG	BI	T80 Y81	T79 Y80
BS04	MG	BI	R68 G69 G70	R67 G68 G69

External links

PDB	RCSB:8oeq, PDBe:8oeq, PDBj:8oeq
PDBsum	8oeq
PubMed
UniProt	Q5A6R1\|RL15A_CANAL Large ribosomal subunit protein eL15 (Gene Name=RPL15A)

[Back to BioLiP]