Structure of PDB 8evq Chain BI

Receptor sequence

>8evqBI (length=188) Species: 4932 (Saccharomyces cerevisiae)

GISRDSRHKRSATGAKRAQFRKKRKFELGRQPANTKIGAKRIHSVRTRGG
NKKYRALRIETGNFSWASEGISKKTRIAGVVYHPSNNELVRTNTLTKAAI
VQIDATPFRQWFEAHYGQTLGKKSKNAERKWAARAASAKIESSVESQFSA
GRLYACISSRPGQSGRCDGYILEGEELAFYLRRLTAKK

3D structure

• PDB: 8evq Regulation of translation by ribosomal RNA pseudouridylation.
• Chain: BI
• Resolution: 2.72 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BI	G2 R5 D6 R8 K10 R11 T14 A16 R18 F21 R22 K23 K24 R25 K26 F27 L29 R31 Q32 P33 K41 R42 I43 H44 R47 T48 R49 G50 K54 R56 N64 S66 I72 S73 K75 S86 N87 K98 A99 W112 K137 N138 K142 R146 S170 S171 R172 Q175 R178 D180	G1 R4 D5 R7 K9 R10 T13 A15 R17 F20 R21 K22 K23 R24 K25 F26 L28 R30 Q31 P32 K40 R41 I42 H43 R46 T47 R48 G49 K53 R55 N63 S65 I71 S72 K74 S85 N86 K97 A98 W111 K125 N126 K130 R134 S158 S159 R160 Q163 R166 D168
BS02	rna	BI	R77 R92 A162 R164 K200	R76 R91 A150 R152 K188

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:0030686 90S preribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8evq, PDBe:8evq, PDBj:8evq
• PDBsum: 8evq
• PubMed: 37595043
• UniProt: P0CX39|RS8A_YEAST Small ribosomal subunit protein eS8A (Gene Name=RPS8A)